Microbiology Reader
Equipment to run microbiology work automatically

Growth Curves of any strain.
Microbiological calculations.

Microbiology Home
Microbioloy Reader
Growth Curves
Photo Album
Microorganisms
Software
Download
Purchasing
Contact Us

Scientific Publications - Work Done by Microbiology Reader Bioscreen C

Free Online Full-text Article

J. Biol. Chem., Vol. 277, Issue 1, 32-39, January 4, 2002

Three Oligopeptide-binding Proteins  are Involved in the Oligopeptide Transport  of Streptococcus thermophilus*
 

Peggy Garault, Dominique Le Bars, Colette Besset, and Véronique MonnetDagger

From the Unité de Biochimie et Structure des Protéines, Institut National de la Recherche Agronomique, 78352 Jouy en Josas cedex, France

Received for publication, July 24, 2001, and in revised form, October 15, 2001

    ABSTRACT

The functions necessary for bacterial growth strongly depend on the features of the bacteria and the components of the growth media. Our objective was to identify the functions essential to the optimum growth of Streptococcus thermophilus in milk. Using random insertional mutagenesis on a S. thermophilus strain chosen for its ability to grow rapidly in milk, we obtained several mutants incapable of rapid growth in milk. We isolated and characterized one of these mutants in which an amiA1 gene encoding an oligopeptide-binding protein (OBP) was interrupted. This gene was a part of an operon containing all the components of an ATP binding cassette transporter. Three highly homologous amiA genes encoding OBPs work with the same components of the ATP transport system. Their simultaneous inactivation led to a drastic diminution in the growth rate in milk and the absence of growth in chemically defined medium containing peptides as the nitrogen source. We constructed single and multiple negative mutants for AmiAs and cell wall proteinase (PrtS), the only proteinase capable of hydrolyzing casein oligopeptides outside the cell. Growth experiments in chemically defined medium containing peptides indicated that AmiA1, AmiA2, and AmiA3 exhibited overlapping substrate specificities, and that the whole system allows the transport of peptides containing from 3 to 23 residues.


    INTRODUCTION

Oligopeptide transport systems are key channels between the environment and the inner part of micro-organisms, which have been described in numerous Gram-negative and Gram-positive bacteria. They generally internalize peptides with an ATP-driving force and belong to the ABC transporter family (1). They are composed of oligopeptide-binding proteins (OBP),1 which are periplasmic in Gram-negative bacteria and membrane-associated in Gram-positive bacteria; transmembrane proteins that form a channel for the passage of oligopeptides and inner membrane-associated ATPases, which provide the energy for transport.

The oligopeptide transport system of Gram-negative bacteria (Escherichia coli and Salmonella typhimurium) transports peptides up to hexapeptides. This size limit seems to be imposed by the outer membrane pores rather than by the transporter itself (2). In Gram-positive bacteria, the size of the peptides transported is more variable. Peptides from 2 to 7 residues and of 6-7 residues are transported by the oligopeptide transport system of Streptococcus pneumoniae (3) and Streptococcus gordonii (4), respectively. In Lactococcus lactis and Listeria monocytogenes, the oligopeptide transport system is capable of internalizing peptides composed of 4-18 amino acids (5) and of 5-8 amino acids (6). Thirty years ago, Desmazeaud and Hermier (7) demonstrated that peptides having a mass included between 1000 and 2500 and containing lysine or arginine have a stimulatory effect on the growth of S. thermophilus, whereas larger peptides (masses of 5000) inhibit it. Mixtures of amino acids contained in stimulatory peptides have the same stimulant effect on growth, which demonstrates that stimulatory peptides act as amino acid source. The requirements of S. thermophilus for peptides with specific length were explained by the likely presence of a peptide transport system different from that described in E. coli.

The most obvious role of these systems is to supply bacteria with essential amino acids in a low energy fashion. In the case of lactic acid bacteria, which are auxotrophic for several amino acids (8-10) and which are used to growing in milk, a medium containing a low level of free amino acids (11), the oligopeptide transport system is fundamental to optimal growth. In addition to two di-tripeptide transport systems in L. lactis (a proton motive force-driven di-tripeptide carrier (DtpT) (12-14), and an ATP-driven di-tripeptide transporter (DtpP) (15, 16), an oligopeptide transport system (Opp) (13, 17), which internalizes oligopeptides released from caseins by the action of cell wall proteinase, allows L. lactis to grow in milk.

In the present work, we have identified and characterized the oligopeptide transport system of S. thermophilus. We demonstrate that it works with three functional oligopeptide-binding proteins, that it is capable of transporting entities as large as 23 amino acid peptides, and that it plays a major role in nutrition.

    EXPERIMENTAL PROCEDURES

Bacterial Strains, Media, and Culture Conditions-- The strains used in this work were described in Table I. All E. coli strains were grown on Luria-Bertani medium (18) at 37 °C with shaking and in the presence of erythromycin (Em, 150 µg/ml) when required. Three media were used for S. thermophilus cultures. The first medium was reconstituted, low heat skim milk (10% w/v) (Nilac, Nederlands Instituut von Zuivelonderzoek, Ede, The Netherlands), autoclaved at 110 °C for 12 min, buffered with 0.75 mM sodium glycerophosphate and, in some cases, containing bactotryptone at 3 g/liter (pancreatic digest of casein; Difco Laboratories, Detroit, MI). Bacterial growth was monitored by measuring optical density (OD) at 480 nm after clarification of the milk by a 10-fold dilution in 2 g/L EDTA pH 12 (19). Two other media were used for general cultures and growth rate experiments. The first was M17Lac medium (20), in which bacterial growth was monitored by measuring the OD at 600 nm. The second was a chemically defined medium (CDM) containing nucleotides, vitamins, salts, potassium phosphate buffer (0.05 mol·liter-1, pH 6.7) and 0.5% lactose (w/v) as described by Letort and Juillard (21), and sterilized by filtration. The nitrogen source of the CDM was provided by amino acids, a mix of amino acids associated with a single peptide (Sigma) or alpha s2-casein trypsic hydrolysate, sterilized by filtration. Peptides MK, MH, EA, ED, EPET, PQFY, DYM, DYMG, YGGFM, RPKPQQFFGLM, MKRPPGFSPFR, ACTH-(1-17) fragment (SYSMEMFRWGKPVGKKR), ACTH-(1-24) fragment (SYSMEMFRWGKPVGKKRRPVKVYP), and oxidized B chain of insulin (FVNQHLCGSHLVEALYLVCGERGFFYTPKA) were used at rate of 100 µmol·liter-1 in the culture medium. Growth rate experiments were then performed at 37 °C using a Microbiology Reader Bioscreen C (Labsystems, Helsinki, Finland) in 100-well, sterile, covered microplates. Each well contained 200 µl of the culture medium. Overnight M17Lac cultures of S. thermophilus were washed twice and resuspended in a volume of sterile potassium phosphate buffer (0.05 mol·liter-1, pH 6.7) equal to the culture volume. 4 µl of the suspension were used to inoculate each well. The optical density was measured at 600 nm every 20 min, after gentle shaking. The apparent growth rate (µmax) was defined as the maximum slope of a semi-logarithmic representation of growth curves, assessed by OD measurements.

DNA Manipulations and Sequencing-- Plasmid DNA manipulations and transformations of E. coli were performed as described previously (18). RNA was prepared as previously described from S. thermophilus grown in M17Lac (18). The total DNA of integrants obtained by insertional mutagenesis (see below) were digested by EcoRI or HindIII, and then ligated. TIL206 electrocompetent cells were transformed with ligation products, and EmR colonies were screened by PCR after 24-h incubation at 37 °C.

PCR amplifications were performed with the Gene Amp PCR system 2400 (PerkinElmer Life Sciences Inc.) using Taq polymerase (Appligene Oncor, Illkirch, France) and oligonucleotides from pG+h9::ISS1 sequences (5'-ACTACTGACAGCTTCCAAGGA-3' and 5'-ATAGTTCATTGATATATCCTC-3' for EcoRI digestion and 5'-GTAAAACGACGGCCAGTG-3' and 5'-TATCTACTGAGATTAAGGTCT-3' for HindIII digestion). The Dye Terminator kit and a 310 Genetic Analyzer (Applied Biosystems, Foster City, CA) were used for DNA sequencing; each strand was sequenced twice on independent PCR products. DNA sequences were analyzed with Genetics Computer Group (GCG) sequence analysis software from the University of Wisconsin (22) and Mail Fasta (National Center for Biotechnology Information). Internal amiA2 and amiA3 fragments were amplified using degenerated oligonucleotides (5'-TTGTWTACWTCWGAWGGHGAAGA-3'; 5'-ACTATCWRTYAACCAWGCTTG-3') corresponding to conserved sequences of streptococcal oligopeptide-binding proteins (Refs. 3 and 4; this work). Annealing was performed at 54 °C. Additional reverse PCRs were performed to amplify fragments flanking the known parts of amiA1/amiA2/amiA3 genes. The total DNA of the St18 strain was completely digested by HindIII, EcoRI, TaqI, HaeII, HhaI, PstI, or NsiI, ligated in a dilute form (1 µg/ml), and amplified by PCR.

Southern and Northern hybridizations were performed using a Positive nylon membrane for transfer (Appligene Oncor, Illkirch, France) according to the instructions in the ECL detection system (Amersham Biosciences, Inc., Buckinghamshire, United Kingdom).

S. thermophilus Insertional Mutagenesis, Construction of Oligopeptide-binding Protein, and Protease Mutants-- Insertional mutagenesis with pG+h9::ISS1 in S. thermophilus St18 had previously been adapted from the method described by Maguin et al. (23, 24). Integrants affected for their growth in milk were selected on Fast Strain Differencing Agar medium (25).

The genes encoding oligopeptide-binding proteins amiA1, amiA2, amiA3, and the gene encoding cell wall proteinase prtS (26) were inactivated in the St18 strain using the pG+h9 gene replacement system. The mutants obtained are listed in Table I. Deletions were made in the middle of target genes amplified from the DNA St18 strain, as follows. PCR fragments of amiA genes were cloned into the pGEMt easy vector (Promega) according to the manufacturer's instructions. amiA2 deletion was obtained by double digestions with PshAI and BstSNI followed by a ligation step. The partially deleted amiA2 gene fragment was then cloned into pG+h9. Fragments of amiA1 and amiA3 genes were cloned in pG+h9, digested by AvaII for amiA1 and Bsp120I and BstXI for amiA3, and ligated to obtain amiA1 and amiA3 deletions. For the prtS mutant, a PCR fragment gene was first cloned into the TopoXL vector (Invitrogene), according to the manufacturer's instructions. The prtS gene fragment was cloned in pG+h9, and a deletion was obtained by HpaI and NruI digestion followed by ligation. The procedures for S. thermophilus electroporation, pG+h9 integration, and excision were similar to those used for insertional mutagenesis, as described previously (24, 27).

 

Table I
Strains and plasmids
 

Experimental Growth in the Presence of a Toxic Peptide-- The ability of a toxic peptide analog (aminopterin) to inhibit bacterial growth on M17Lac plates was quantified by determining the extent of the inhibitory zone surrounding a filter paper disc saturated with 30 µg of aminopterin (Sigma).

Mass Spectrometry Analysis-- Cells were grown in CDM with alpha s2-casein trypsic hydrolysate as the nitrogen source containing more than 30 different peptides (28). Cells were cultured for 13 h and then centrifuged (5 min, 5000 × g). Culture supernatants were concentrated and desalted with ZipTip (Millipore). Mass spectra were recorded in the positive-ion reflectron mode on a Voyager DE-STR mass spectrometer (Perspective Biosystems, Framingham, MA). All experiments were performed using a 20-kV acceleration voltage, a 337-nm laser, and 100-ns delayed extraction. The matrix solution was prepared freshly by dissolving 10 mg of alpha -cyano-4-hydroxycinnamic acid (Sigma) in 70/30 acetonitrile/trifluoroacetic acid, 0.3%. 0.5 µl of the sample was mixed with 0.5 µl of the matrix solution, spotted on a stainless steel sample plate, and air-dried.

    RESULTS

Characterization of One Mutant with Slower Growth in Milk-- The insertional mutagenesis in S. thermophilus St18 produced 1.183 × 104 EmR integrants. Based on their phenotype on Fast Strain Differencing Agar, we selected 75 of them. After Southern analysis of the digested chromosomal DNAs of integrants growing slowly in milk, we selected 14 clones in which pG+h9::ISS1 was integrated at only one locus, distinct in each one of them. In 12 clones, pG+h9::ISS1 was tandemly integrated, exhibiting two hybridization bands using pG+h9 as a probe, whereas the 2 remaining clones contained only one copy of pG+h9::ISS1. The growth rate of one of the mutants, called the insertion sequence (IS) mutant throughout this paper, was significantly lower in milk (0.19 h-1) than that of the wild type strain (0.79 h-1). Rapid growth was restored by the addition of bactotryptone (growth rate of 0.75 h-1 for the mutant and of 0.85 h-1 for the wild type strain), suggesting that the affected function was related to nitrogen nutrition.

The sequence of the interrupted gene of the IS mutant was determined using oligonucleotides from pG+h9::ISS1. We obtained a 392-bp sequence for the IS mutant, which formed part of an ORF exhibiting homologies with fragments of genes encoding oligopeptide-binding proteins (OBPs) from Streptococci, Bacilli, and L. monocytogenes (Refs. 3, 4, 29, and 30; accession no. AF305387). By applying additional reverse PCRs, we obtained a single 7032-bp DNA fragment containing the entire ORF corresponding to the interrupted gene of the IS mutant, together with four additional ORFs displaying a high level of homology with amiC, amiD, amiE, and amiF from different streptococci. These five ORFs, called amiA, amiC, amiD, amiE, and amiF, constituted the five proteins of ATP-binding cassette transporters (31); by homology, we named the S. thermophilus genes amiA1, amiC, amiD, amiE, and amiF. Protein sequences deduced from the entire DNA sequence exhibited the greatest homology with similar proteins from S. pneumoniae (ranging from 62% identity for AmiA1 to 86% identity for AmiE), S. gordonii (56% identity for AmiA1), and S. pyogenes (48% identity for AmiA1). Analysis of the sequence revealed the presence of a putative -10 extended promoter sequence situated 35 bp upstream of the ATG start codon of amiA1, and of a putative terminator situated 8 bp downstream of the stop codon of amiF.

Presence of Three Homologous Oligopeptide-binding Proteins in S. thermophilus-- The Southern hybridization under nonstringent conditions of HindIII- and EcoRI-digested St18 strain DNA, using a 1400-bp fragment of amiA1 as a probe, revealed two and three bands, respectively, suggesting the presence of at least two homologous genes (Fig. 1). Using PCR with degenerated oligonucleotides deduced from conserved regions of OBPs from streptococci and DNA from the IS mutant to avoid the amplification of an amiA1 gene fragment, we obtained two 1400-bp PCR products corresponding to two fragments of genes, named amiA2 and amiA3, homologous to each other and to amiA1. With additional PCRs, we obtained 2938- and 3089-bp sequences containing entire amiA2 and amiA3 genes, respectively. Comparisons of AmiA1, AmiA2, and AmiA3 protein-deduced sequences revealed a very strong identity between the three proteins (97.6% identity between AmiA1 and AmiA2, 87.1% identity between AmiA1 and AmiA3). amiA1, amiA2, and amiA3 encode proteins with 655, 655, and 657 residues, respectively. Their primary sequences contain a putative membrane lipoprotein lipid attachment site (VLAACS) (32), an extracellular peptide and nickel-binding protein family signature sequence (A7D2TYYIRKGIKW) (1). These features indicate the probable covalent attachment of AmiA proteins to the bacterial membrane.

 


Fig. 1.   Demonstration of the presence of additional oligopeptide-binding proteins by Southern hybridization of St18 strain DNA with an amiA1 probe. Chromosomal DNA of St18 strain was digested by EcoRI or HindIII (lanes 1 and 2), with the amiA1 gene being used as a probe. The SMART ladder marker (Eurogentec) was used as a size reference.
 

Analysis of the DNA sequences revealed the presence of putative -10 extended promoter sequences upstream of the amiA2 and amiA3 start codons, and of putative terminators downstream of the stop codons of the same genes. No open reading frames homologous to other genes encoding oligopeptide transport components were located either 590 and 1130 bp upstream or 500 and 400 bp downstream of the amiA2 and amiA3 genes, respectively. The amiA3 promoter region differed from that of the two other amiA genes because of the presence of four potential -10 extended promoter sequences, including two inverted repeat sequences (Fig. 2).

 


Fig. 2.   Sequence analysis of the promoter regions of the amiA genes. A, sequence comparison of the promoter regions of amiA genes. pn, potential -10 extended promoter sequences (in boxes); inverted repeats are indicated by arrows. Bold type indicates consensus sequences of -10 extended promoters, RBS sequences, and start codons. B, inverted repeat sequences identified upstream of the amiA3 gene.
 

Upstream of the three amiAs, we found part of insertion sequences or transposable elements (Fig. 3). A shuffled IS1193 (GenBankTM accession no. STIS1193) was found upstream of the amiA1 and the amiA2 sequences. The environment upstream of amiA3 differed from that of the other two amiA genes because of the presence of a L. lactis IS904 (33). Downstream of the amiA2 and amiA3 genes, we sequenced a part of S. thermophilus IS1193.

 


Fig. 3.   Schematic representation of amiA genes and respective environment. Positions of potential promoters () and terminators (). , shuffled IS1193; , IS1193; , L. lactis IS904.
 

PCR screening of 21 industrial and three CNRZ collection S. thermophilus strains, using the same degenerated oligonucleotides as those used to search for amiA2 and amiA3, demonstrated the presence of at least one copy of an amiA gene in all strains. Southern analysis of 12 S. thermophilus strains, using EcoRI-digested DNA and amiA2 as a probe, highlighted the presence of several large hybridization bands (some larger than 6000 bp; data not shown). These results suggested that the presence of several amiA in S. thermophilus is a general characteristic of this species.

The Three Oligopeptide-binding Proteins Are Functional-- The first prerequisite for oligopeptide-binding protein to be functional is expression of the corresponding genes. Northern blot analysis revealed the presence of a 7000-bp transcript hybridizing with a 1860-bp amiA2 fragment (Fig. 4). This demonstrated that the potential promoter and terminator sequences identified upstream of amiA1 and downstream of amiF, respectively, were functional, and that the amiA1, -C, -D, -E, and -F genes were organized into an operon. Northern blot analysis revealed another 2000-bp transcript hybridizing with the 1860-bp amiA2 fragment, indicating that the potential promoter and terminator sequences identified upstream and downstream of amiA2 and/or amiA3 genes are functional. This result was confirmed by Northern blot analysis after RNA preparation of the IS mutant, which revealed the same 2000-bp transcript hybridizing with the same 1860-bp amiA2 probe. As expected in this case, no 7000-bp transcript corresponding to an ami operon was visible for the RNA preparation of the IS mutant (data not shown).

 


Fig. 4.   Northern analysis of the S. thermophilus wild type strain. RNA was prepared from bacteria grown in M17Lac medium, and amiA2 probe was used. RNA marker (0.2-10 kb; Sigma) was used as size reference.
 

As a second stage, we constructed stable negative mutants for oligopeptide-binding proteins by gene replacement (23) and measured their growth rate in milk. Mutations in the three AmiA-encoding genes were achieved to obtain an AmiA triple negative mutant.

Growth of the AmiA1- and AmiA2- mutants was comparable with that of the wild type strain in milk, whereas that of the AmiA3- mutant was significantly lower (Fig. 5). The AmiA1/A2/A3- triple mutant exhibited very slow, limited growth in milk, similar to that seen for the IS mutant. This observation confirmed that there are probably no other oligopeptide-binding proteins working with the same system. In addition, we concluded that the mutation in the IS mutant affected the whole operon of oligopeptide transport. This result explained why the AmiA1 mutant and IS mutant exhibited different phenotypes. This was confirmed by the absence of an ami operon transcript on the Northern blot performed with the RNA of the IS mutant. The significant difference in the growth rates of the AmiA3- and AmiA1/A2/A3- mutants indicated that, in addition to AmiA3, at least one other AmiA was functional. At this stage in our work, we concluded that at least two of the three AmiA were functional and functioned with the same permease.

 


Fig. 5.   Growth rate (µmax) of S. thermophilus wild type strain and amiA derivative mutants in milk.
 

The St18 strain is endowed with a cell wall proteinase, PrtS, that degrades proteins and peptides in smaller peptides (26). We constructed each AmiA/PrtS double mutant as well as the AmiA1/A3/PrtS- triple mutant to study the functionality of AmiA proteins independently of extracellular peptide degradation by the cell wall proteinase, PrtS. For technical reasons, we were unable to obtain the AmiA1/A2/A3/PrtS- quadruple mutant. We used CDM containing a trypsic hydrolysate of alpha s2-casein as the nitrogen source to compare the effects of AmiA mutations on AmiA/PrtS- mutants. The growth of all AmiA/PrtS- mutants was slower than that of the single mutant, PrtS-. More specifically, growth of the AmiA1/PrtS- and AmiA2/PrtS- mutants was half and one third less rapid, respectively, than that of the PrtS- mutant, indicating that AmiA1 and AmiA2 are functional (data not shown). Based on growth experiments in milk and CDM, we concluded that the three AmiA oligopeptide-binding proteins were functional.

The Three Oligopeptide-binding Proteins Have Overlapping Substrate Specificities-- The simplest way to measure peptide uptake is based on the ability of an auxotrophic strain to utilize peptides as an amino acid source when all the peptidases have an intracellular location, as is the case for S. thermophilus (34). Internalized peptides are then rapidly hydrolyzed by a battery of highly active intracellular peptidases. The rate-limiting step to peptide utilization in Ami mutants is their transport into the cytoplasm because the St18 strain has the same pool of peptidases as AmiA mutants of the ST18 strain.

We studied the specificities of AmiA proteins in two stages. First, they were compared by analyzing the external medium of each AmiA/PrtS mutant in CDM, in which nitrogen was supplied by a mixture of peptides. We grew PrtS and AmiA mutants in CDM with a trypsic hydrolysate of alpha s2-casein as the nitrogen source. After growth, the culture supernatants were analyzed by mass spectrometry. The presence or absence of a peptide in the supernatant indicated complete or incomplete utilization of a peptide by a mutant. Analysis of the culture supernatants revealed differences in peptide composition. Several peptides were totally consumed by the PrtS- mutant but not by AmiA/PrtS- mutants. Their identification provided an indication of the specificities of OBPs. Most differences were found with AmiA3- mutants where some peptides were still present in the medium after growth, although they had completely disappeared from the culture medium of other AmiA and PrtS mutants. Among the most demonstrative examples, presented in Table II, the 92-114 alpha s2-casein fragment (FPQYLQYLYQGPIVLNPWDQVKR) was still present in the culture supernatants of AmiA3/PrtS- and AmiA1/A3/PrtS- mutants, but not in that of the PrtS- strain or AmiA1/PrtS- and AmiA2/PrtS- mutants. From these MS analyses, we therefore concluded that large peptides were used by the St18 strain and that the AmiA3 protein was capable of binding the peptides of at least 23 residues.

 

Table II
Presence or absence of peptides after the growth of AmiA and PrtS negative mutants in CDM with peptides from alpha s2-casein hydrolysate as the sole amino acid source
 

Peptide hydrophobicity values were calculated according to Kyte and Doolittle (45).

During a second stage, St18 wild type strain, PrtS, AmiA/PrtS, and AmiA1/AmiA2/AmiA3 negative mutants were cultured in CDM containing a single peptide as a source of methionine or glutamate (the St18 strain is auxotrophic for methionine and glutamate). None of the strains was able to grow with EA and ED as the source of glutamate or with ACTH-(1-17) or -(1-24) fragments, the oxidized B chain of insulin as the sole source of methionine. The wild type, PrtS-, and AmiA/PrtS- strains were capable of growing, without significant differences in their growth rates, with the other peptides tested. The AmiA1/A2/A3- negative mutant was the only one whose growth was really affected. It grew on CDM containing MH, MK, YGGFM, or MKRPPGFSPFR but not in CDM containing DYM, DYMG, or RPKPQQFFGLM (Fig. 6). With YGGFM and MKRPPGFSPFR, the growth rate achieved was less than 60% of that seen in the St18 wild type strain. The residual growth observed with this peptide and the triple mutant was probably caused by the action of the proteinase and subsequent transport of the peptide degradation products. The comparable growth rates in different media for all Ami/PrtS- mutants (data not shown) indicated that the three Ami proteins have overlapping specificities. The growth rates obtained with MH or MK dipeptides were the same as for the wild type strain and AmiA1/A2/A3-, indicating the probable existence of a dipeptide transport system in the St18 strain and the absence of exclusive transport of these dipeptides by the Ami system of the St18 strain.

 


Fig. 6.   Growth rate (µmax) of S. thermophilus wild type strain and amiA triple negative mutant in CDM containing a peptide as the methionine source.
 

Ability of AmiA Mutants to Grow on Aminopterin-- We tested the different Ami mutants for their ability to grow in the presence of a toxic peptide analog, aminopterin (Table III). Aminopterin was transported by the Ami system because the AmiA1/A2/A3- mutant was not sensitive to aminopterin, whereas St18 was sensitive. At least AmiA2 and AmiA3 are involved in the transport of aminopterin because the growth of both the AmiA1/A2- and AmiA1/A3/PrtS- mutants was inhibited by aminopterin. AmiA2- and AmiA1/A2- mutants were more sensitive to aminopterin than the St18 wild type strain, suggesting an increase in the transport of aminopterin by AmiA3 protein.

 

Table III
Inhibition of S. thermophilus and AmiA negative mutants by aminopterin
 

The radius of S. thermophilus growth-inhibitory zone surrounding a filter paper disc saturated with 30 µg of aminopterin was measured. Two independent experiments were performed and gave identical radius values, which are reported in the table.



    DISCUSSION

Oligopeptide Uptake Is Essential to the Growth of S. thermophilus in Peptide-containing Media-- In addition to cell wall protease and the purine and branched-chain amino acid biosynthesis pathways, the oligopeptide transport system is one of the functions necessary for the optimum growth of S. thermophilus in milk (26, 24, 35). Amounts of free amino acids and peptides are limited in this medium and do not allow the optimum growth of lactic acid bacteria (36). Two elements are essential to ensure bacterial growth: cell wall protease, which hydrolyzes the caseins into oligopeptides and an oligopeptide transport system capable of internalizing the peptides. These two elements have been extensively studied in the reference lactic acid bacteria, L. lactis (37). The cell wall protease has been only recently described in S. thermophilus, (26), and we report herewith the first characterization of the oligopeptide transport system. Both transport systems from L. lactis and S. thermophilus are ABC transporters, are of the same importance, and fulfill the same nutritional function. However, they have different compositions because the lactococcal system is, in most strains, encoded by an operon containing only one OBP-encoding gene (oppA) (37), whereas S. thermophilus expresses three homologous OBPs (amiA1, amiA2, and amiA3). Similar organizations, reported for S. pneumoniae and S. gordonii (ami and hpp systems, respectively), are also essential for the uptake of oligopeptides from media containing peptides as the nitrogen source (4, 38). The different reductions in the growth rates of AmiA mutants in a peptide-containing medium demonstrates that the three S. thermophilus OBPs are not of the same importance to the nutrition process. Inactivation of the amiA3 gene had the most negative effect on growth rate in the peptide-containing medium. In S. pyogenes, the opp transport system is not essential for growth in complex media, which may contain sufficient di- and tripeptides and amino acids to ensure normal growth. This observation implies the existence of functional di- and tripeptide transport system(s) (29). Two di- and tripeptide transport systems have also been characterized in L. lactis (12, 15). At least one dipeptide transport system should be present and functional in S. thermophilus because both the wild type strain St18 and the triple mutant AmiA1/A2/A3- grew in the presence of methionine-containing dipeptides.

An S. thermophilus Oligopeptide Transport System Involving Three Oligopeptide-binding Proteins-- We sequenced a 7032-bp S. thermophilus DNA fragment comprising five genes in an operon structure and encoding a functional oligopeptide transport system. It belongs to the superfamily of ATP-binding cassette transporters, which are widespread in both Gram-negative and Gram-positive bacteria. The fragment encoding the Ami system was composed of AmiC and AmiD integral membrane proteins, AmiE and AmiF ATP-binding proteins, and a substrate binding protein, AmiA1.

In addition, we demonstrated the presence of two other oligopeptide-binding proteins, AmiA2 and AmiA3, encoded by isolated chromosome genes and working with the same permease system. This feature appears to be typical of streptococci, as the presence of three homologous oligopeptide-binding proteins has already been described in S. pneumoniae and S. gordonii (3, 4). Another example of multiple oligopeptide-binding proteins was reported for Borrelia burgdorferi containing three chromosome-encoded OBPs (39) and two plasmid-encoded OBPs (40). In other cases, the gene encoding an OBP and included in an operon is transcribed independently, i.e. at a higher level than the rest of the operon. In S. pyogenes and L. monocytogenes, the presence of a terminator downstream of oppA (the oligopeptide-binding protein-encoding gene) allows such an independent transcription (29, 30). The sole oppA in L. lactis, the last gene of the opp operon, is preceded by a promoter, which also permits its independent transcription (17).

The homology between the three oligopeptide-binding proteins we identified in S. thermophilus is especially strong (97.6% between AmiA1 and AmiA2, 87.1% between AmiA1 and AmiA3) and much higher than those observed between homologous proteins in S. pneumoniae and S. gordonii, which exhibit identity reaching approximately 60% (3, 4). The strong identity found for the three AmiA proteins in S. thermophilus is probably a result of the recent and double duplication of the amiA1 gene. The presence of IS upstream and downstream of amiA2 and amiA3 genes suggests the involvement of an IS-directed mobilization of amiA. The available sequenced part of the genome of the S. thermophilus LMG 18311 strain (data not shown; accessible at www.biol.ucl.ac.be/gene/blast/blast.html) reveals the presence of at least two ORFs encoding potential proteins homologous to AmiA1 and AmiA2 of the St18 strain. Similar to our observation in strain ST18, we found an IS in the neighborhood of these genes in the sequence of the LMG 18311 strain. No insertion sequences have been reported in the close vicinity of the OBP-encoding genes of other streptococcal species, suggesting that the origin of the multicopies differs in the case of S. thermophilus.

The duplication of AmiA genes is probably beneficial to S. thermophilus. The high number of OBP copies may facilitate the transport of oligopeptides by modifying the stoichiometry of the transporter. Using a mathematical model adapted to Gram-negative bacteria in which the binding proteins are generally free in the periplasm, Bohl et al. (41) demonstrated that the concentration of binding proteins influenced the kinetic parameters of transport. In this kind of model, binding proteins would facilitate the movement of substrates within the periplasm. In Gram-positive bacteria, binding proteins are generally linked to the membrane through their lipid moiety, as is probably the case for the OBPs from S. thermophilus. Their mobility is consequently reduced and restricted to the membrane. Their role may be to limit to two dimensions the diffusion of substrates in the close vicinity of the transporter, and thus becomes more important with their copy number (31). Another hypothesis has already been proposed for streptococcal OBPs (3, 4); the interaction of binding proteins with each other is necessary for substrate binding and uptake to occur. This suggestion is supported by the different phenotypes of two insertional mutations in hppG (one of the OBP-encoding genes in S. gordonii), leading to the absence or the production of a truncated protein and allowing or preventing growth on peptides, respectively. In this case, the formation of a multireceptor cell surface complex would be an efficient means of increasing permease affinity for peptides (4). This hypothesis was not confirmed by our findings because none of our single AmiA mutants, producing one in three truncated OBPs, totally lost its capacity for oligopeptides uptake.

Regulations between OBPs and between OBPs and PrtS are strongly suggested by growth experiments and amiA promoter sequences analysis and need to be further investigated.

Specificities of AmiA Proteins-- We demonstrated in this work that the three AmiA of S. thermophilus exhibit different but overlapping specificities. AmiA3 is the most distinctive, which is in agreement with its markedly different protein sequence. The entire Ami system is capable of transporting peptides containing from 3 to 23 amino acids as well as aminopterin, as demonstrated in growth experiments. However, like other transport systems (42), peptide size is not the only parameter to be taken into account, as 17- and 24-amino acid fragments of adrenocorticotropic hormone, which are relatively hydrophilic (average hydrophobicity: -1.62 and -1.23) were not internalized by the Ami system. Peptide hydrophobicity probably favors their transport, especially via AmiA3. The Opp system in L. lactis has been extensively studied and exhibits greater affinity for nonapeptides, although it is capable of binding up to 35-residue peptides and also preferentially transporting hydrophobic peptides. In the Streptococcus genus, the data available indicate that peptide hydrophobicity negatively influences the growth rate of oral streptococci, at least in the case of S. mutans and S. sanguis (43). No transport of peptides containing more than 10 amino acids has been reported in streptococci. In S. pneumoniae, peptides containing from 2 to 7 amino acids are transported by the Ami system, but longer peptides have not been tested. In S. gordonii, inactivation of the three OBP-encoding genes results in a loss of ability to utilize specific 5-7-amino acid peptides for growth, whereas the utilization of peptides containing from 2 to 5 and 8 or 9 amino acids remains possible, probably because of the activity of an extracellular protease (44).

An Atypical Oligopeptide Transport System in S. thermophilus-- S. thermophilus is atypical of both the lactic acid bacteria family, where it is the only streptococcus sensus stricto, and the Streptococcus genus, where it is nonpathogenic and used in food processing. The only natural medium known for the development of S. thermophilus is milk, a medium in which oligopeptide transport is essential for growth. The oligopeptide transport system of S. thermophilus we have described in this work is also atypical. We have demonstrated the ability of S. thermophilus to transport oligopeptides containing from 3 to 23 amino acids, with a preference for hydrophobic oligopeptides similar to those found in L. lactis. However, although an ABC transporter is involved in both cases, the genetic organization of the systems clearly differs. We describe herewith three highly homologous copies of oligopeptide-binding proteins, which exhibit only 24.2% identity with the only OBP in the Opp system of L. lactis (Table IV). The organization of the system with three OBPs copies is clearly of a streptococcal type. However, the specificity of the oligopeptide transport we describe for S. thermophilus is considerably broader than that already reported for other streptococci.

 

Table IV
Homology between Ami proteins in the Ami system of the S. thermophilus St18 strain and those in S. pneumoniae (Ami system; Ref. 3) and L. lactis (Opp system; Ref. 17)
 

Percentage identities are given as determined by the BestFit program (22).



    ACKNOWLEDGEMENTS

We thank Annie Sepulchre, Patricia Ramos, Jérôme Mengaud, Vincent Juillard, and Françoise Rul for assistance and critical reading of the manuscript, Michčle Nardi for excellent technical advice and critical reading of the manuscript, and Christian Beauvallet for mass analyses.

    FOOTNOTES

* This work was supported by Danone Vitapole Recherche, Rhodia-Food, and Sodiaal.The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

 

Dagger To whom correspondence should be addressed. Tel.: 33-1-34-65-21-49; Fax: 33-1-34-65-21-63; E-mail: monnet@jouy.inra.fr.

 

Published, JBC Papers in Press, October 15, 2001, DOI 10.1074/jbc.M107002200

    ABBREVIATIONS

The abbreviations used are: OBP, oligopeptide-binding protein; Em, erythromycin; OD, optical density; CDM, chemically defined medium; ORF, open reading frame; IS, insertion sequence.

    REFERENCES


1. Tam, R., and Saier, M. H. (1993) Microbiol. Rev. 57, 320-346
2. Payne, J. W., and Smith, M. W. (1994) Adv. Microb. Physiol. 36, 1-80
3. Alloing, G., de Philip, P., and Claverys, J.-P. (1994) J. Mol. Biol. 241, 44-58
4. Jenkinson, H. F., Baker, R. A., and Tannock, G. W. (1996) J. Bacteriol. 178, 68-77
5. Lanfermeijer, F. C, Picon, A., Konings, W. N., and Poolman, B. (1999) Biochemistry 38, 14440-14450
6. Verheul, A., Rombouts, F. M., and Abee, T. (1998) Appl. Environ. Microbiol. 64, 1059-1065
7. Desmazeaud, M., and Hermier, J. H. (1972) Eur. J. Biochem. 28, 190-198
8. Morishita, T., Deguchi, Y., Yajima, M., Sakurai, T., and Yura, T. (1981) J. Bacteriol. 148, 64-71
9. Deguchi, Y., and Morishita, T. (1992) Biosci. Biotech. Biochem. 56, 913-918
10. Cogain-Bousquet, M., Garrigues, C., Novak, L., Lindley, N. D., and Loubiere, P. (1995) J. Appl. Bacteriol. 79, 108-116
11. Thomas, T. D., and Mills, O. E. (1981) Neth. Milk Dairy J. 35, 255-273
12. Smid, E. J., Plapp, R., and Konings, W. N. (1989) J. Bacteriol. 171, 292-298
13. Kunji, E. R. S., Smid, E. J., Plapp, R., Poolman, B., and Konings, W. N. (1993) J. Bacteriol. 175, 2052-2059
14. Hagting, A., Kunji, E. R. S., Leenhouts, K. J., Poolman, B., and Konings, W. N. (1994) J. Biol. Chem. 269, 11391-11399
15. Foucaud, C., Kunji, E. R. S., Hagting, A., Richard, J., Konings, W. N., Desmazeaud, M., and Poolman, B. (1995) J. Bacteriol. 177, 4652-4657
16. Sanz, Y., Lanfermeijer, F. C., Konings, W. N., and Poolman, B. (2001) Biochem. 39, 4855-4862
17. Tynkkynen, S., Buist, G., Kunji, E., Kok, J., Poolman, B., Venema, G., and Haandrikman, A. (1993) J. Bacteriol. 175, 7523-7532
18. Sambrook, J., and Russel, D. W. (2001) Molecular Cloning: A Laboratory Manual , 3rd Ed. , Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY
19. Thomas, T. D., and Turner, K. W. (1977) N. Z. J. Dairy Sci. Technol. 12, 15-21
20. Terzhaghi, B. T., and Sandine, W. E. (1975) Appl. Microbiol. 29, 807-813
21. Letort, C., and Juillard, V. (2001) J. Appl. Microbiol. 91, 1023-1029
22. Devereux, J., Haeberli, P., and Smithies, O. (1984) Nucleic Acids Res. 12, 387-395
23. Maguin, E., Prévost, H., Ehrlich, S. D., and Gruss, A. (1996) J. Bacteriol. 178, 931-935
24. Garault, P., Letort, C., Juillard, V., and Monnet, V. (2000) Appl. Environ. Microbiol. 66, 5128-5133
25. Huggins, A. M., and Sandine, W. E. (1984) J. Dairy Sci. 67, 1674-1679
26. Fernandez-Espla, M.-D., Garault, P., Monnet, V., and Rul, F. (1999) Eur. J. Biochem. 66, 4772-4778
27. Biswas, I., Gruss, A., Ehrlich, S. D., and Maguin, E. (1993) J. Bacteriol. 175, 3628-3635
28. Juillard, V., Guillot, A., Le, Bars, D., and Gripon, J.-C. (1998) Appl. Environ. Microbiol. 64, 1230-1236
29. Podbielski, A., Pohl, B., Woischnik, M., Körner, C., Schmidt, K. H., Rozdzinski, E., and Leonard, B. A. B. (1996) Mol. Microbiol. 21, 1087-1099
30. Borezee, E., Pellegrini, E., and Berche, P. (2000) Infect. Immun. 68, 7069-7077
31. Higgins, C. F. (1992) Annu. Rev. Cell Biol. 8, 67-113
32. Sutcliffe, I. C., and Russel, R. R. B. (1995) J. Bacteriol. 177, 1123-1128
33. Rauch, P. J., Beerthuyzen, M. M., and de Vos, W. M. (1990) Nucleic Acids Res. 18, 4253-4254
34. Rul, F., and Monnet, V. (1997) J. Appl. Microbiol. 82, 695-704
35. Garault, P., Letort, C., Juillard, V., and Monnet, V. (2000) Lait 81, 83-90
36. Mills, O. E., and Thomas, T. D. (1981) N. Z. J. Dairy Sci. Technol. 15, 43-55
37. Kunji, E. R., Fang, G., Jeronimus-Stratingh, C. M., Bruins, A. P., Poolman, B., and Konings, W. N. (1998) Mol. Microbiol. 27, 1107-1118
38. Alloing, G., Granadel, C., Morrison, D. A., and Claverys, J. P. (1996) Mol. Microbiol. 21, 471-478
39. Kornacki, J. A., and Oliver, D. B. (1998) Infect. Immun. 66, 4115-4122
40. Bono, J. L., Tilly, K., Stevenson, B., Hogan, D., and Ross, P. (1998) Microbiol. 144, 1033-1044
41. Bohl, E., Shuman, H. A., and Boos, W. (1995) J. Theor. Biol. 172, 83-94
42. Detmers, F. J. M., Lanfermeijer, F. C., Abele, R., Jack, R. W., Tampé, R., Konings, W. N., and Poolman, B. (2000) Proc. Natl. Acad. Sci. U. S. A. 97, 12487-12492
43. Cowman, R. A., and Baron, S. S. (1990) J. Dent. Res. 69, 1847-1851
44. Juarez, Z. E., and Stinson, M. W. (1999) Infect. Immun. 67, 271-278
45. Kyte, J, and Doolite, R. F. (1982) J. Mol. Biol. 157, 105-132

 

(Full Text online)

 

 

   Scientific Publications - Work Done by Microbiology Reader Bioscreen C

Agricultural Microbiology
Anaerobic Microbiology
Antimicrobial Susceptibility
Artificial Atmosphere
Bioassay of Antibiotics
Biofilm Microbiology
Bioreactor Technology
Biotechnology
Cell Biology
Clinical Microbiology
Environmental Microbiology
Experiments with Yeast
Fermentation
Food Microbiology
Functional Genomics
Gene Technology
Growth Media Development
Growth Rate and Lag Time
Industrial Microbiology
Medical/Pharmaceutical Field
Microbiological Assay
Microbiological Research
Microbiology of Cosmetics

go to a specific theme...

Military Microbiology
Molecular Microbiology
Mutagenicity and Genotoxicity
Oral Microbiology
Patents
Postantibiotic Studies
Soil Microbiology
Spore Microbiology
Veterinary Microbiology
Waste/Wastewater Treatment
Water Microbiology
Wine Microbiology

 


 

© 2005 Transgalactic Ltd (manufacturer of Bioscreen C software) | Privacy Statement | P.O. Box 1393, 00101 Helsinki, Finland, phone: +358 9 85172920, fax: +358 9 8749481, e-mail: microbiology@bionewsonline.com
 

 

 

Last modified: May 25, 2005